Name | PLAC1L Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57983 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PLAC1L(placenta-specific 1-like) The peptide sequence was selected from the middle region of PLAC1L. Peptide sequence YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | OOSP2 |
Conjugate | Unconjugated |
Supplier Page | Shop |