PLAC1L Antibody

Name PLAC1L Antibody
Supplier Novus Biologicals
Catalog NBP1-57983
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PLAC1L(placenta-specific 1-like) The peptide sequence was selected from the middle region of PLAC1L. Peptide sequence YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OOSP2
Conjugate Unconjugated
Supplier Page Shop

Product images