Cytochrome P450 2B6 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57978
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CYP2B6(cytochrome P450, family 2, subfamily B, polypeptide 6) The peptide sequence was selected from the middle region of CYP2B6. Peptide sequence QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CYP2B6
• Conjugate: Unconjugated