LYPD4 Antibody

Name LYPD4 Antibody
Supplier Novus Biologicals
Catalog NBP1-58023
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LYPD4(LY6/PLAUR domain containing 4) The peptide sequence was selected from the N terminal of LYPD4. Peptide sequence MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LYPD4
Conjugate Unconjugated
Supplier Page Shop

Product images