PSG-1 Antibody

Name PSG-1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58028
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PSG1(pregnancy specific beta-1-glycoprotein 1) The peptide sequence was selected from the C terminal of PSG1. Peptide sequence YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PSG1
Conjugate Unconjugated
Supplier Page Shop

Product images