RASL10A Antibody

Name RASL10A Antibody
Supplier Novus Biologicals
Catalog NBP1-58920
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RASL10A(RAS-like, family 10, member A) The peptide sequence was selected from the N terminal of RASL10A (NP_006468). Peptide sequence PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RASL10A
Conjugate Unconjugated
Supplier Page Shop

Product images