LCN12 Antibody

Name LCN12 Antibody
Supplier Novus Biologicals
Catalog NBP1-58052
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LCN12(lipocalin 12) The peptide sequence was selected from the N terminal of LCN12. Peptide sequence GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LCN12
Conjugate Unconjugated
Supplier Page Shop

Product images