Nucleoplasmin-2 Antibody

Name Nucleoplasmin-2 Antibody
Supplier Novus Biologicals
Catalog NBP1-58109
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NPM2(nucleophosmin/nucleoplasmin, 2) The peptide sequence was selected from the N terminal of NPM2 (NP_877724). Peptide sequence LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NPM2
Conjugate Unconjugated
Supplier Page Shop

Product images