Name | PR48 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58174 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PPP2R3B(protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta) The peptide sequence was selected from the C terminal of PPP2R3B. Peptide sequence ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALR |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PPP2R3B |
Conjugate | Unconjugated |
Supplier Page | Shop |