PR48 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-58163
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PPP2R3B(protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta) The peptide sequence was selected from the C terminal of PPP2R3B. Peptide sequence TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILV
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PPP2R3B
• Conjugate: Unconjugated