Bradykinin RB2/BDKRB2 Antibody
| Name | Bradykinin RB2/BDKRB2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59044 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to BDKRB2(bradykinin receptor B2) The peptide sequence was selected from the N terminal of BDKRB2. Peptide sequence MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | BDKRB2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: BDKRB2 Antibody [NBP1-59044] - Jurkat cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7357_BDKRB2%2520Antibody-Western%2520Blot-NBP1-59044-img0002.jpg)
Western Blot: BDKRB2 Antibody [NBP1-59044] - Jurkat cell lysate, concentration 5.0ug/ml.