Name | GPR177/WLS Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59013 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to GPR177(G protein-coupled receptor 177) The peptide sequence was selected from the middle region of GPR177. Peptide sequence DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | WLS |
Conjugate | Unconjugated |
Supplier Page | Shop |