Claudin-15 Antibody
| Name | Claudin-15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59149 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Bovine |
| Antigen | Synthetic peptides corresponding to CLDN15 (claudin 15) The peptide sequence was selected from the C terminal of CLDN15. Peptide sequence LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | CLDN15 |
| Supplier Page | Shop |
Product images
![Western Blot: Claudin-15 Antibody [NBP1-59149] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/5460_Claudin-15-Antibody-Western-Blot-NBP1-59149-img0004.jpg)
Western Blot: Claudin-15 Antibody [NBP1-59149] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.