Myoferlin Antibody

Name Myoferlin Antibody
Supplier Novus Biologicals
Catalog NBP1-59396
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FER1L3(fer-1-like 3, myoferlin (C. elegans)) The peptide sequence was selected from the C terminal of FER1L3. Peptide sequence QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MYOF
Conjugate Unconjugated
Supplier Page Shop

Product images