SLC43A2 Antibody

Name SLC43A2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59373
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC43A2(solute carrier family 43, member 2) The peptide sequence was selected from the N terminal of SLC43A2. Peptide sequence TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC43A2
Conjugate Unconjugated
Supplier Page Shop

Product images