OR6C70 Antibody

Name OR6C70 Antibody
Supplier Novus Biologicals
Catalog NBP1-59363
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR6C70(olfactory receptor, family 6, subfamily C, member 70) The peptide sequence was selected from the C terminal of OR6C70. Peptide sequence GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene OR6C70
Conjugate Unconjugated
Supplier Page Shop

Product images