OR6C75 Antibody

Name OR6C75 Antibody
Supplier Novus Biologicals
Catalog NBP1-59362
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR6C75(olfactory receptor, family 6, subfamily C, member 75) The peptide sequence was selected from the middle region of OR6C75. Peptide sequence SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR6C75
Conjugate Unconjugated
Supplier Page Shop

Product images