TMEM126B Antibody

Name TMEM126B Antibody
Supplier Novus Biologicals
Catalog NBP1-59768
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMEM126B(transmembrane protein 126B) The peptide sequence was selected from the N terminal of TMEM126B. Peptide sequence AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMEM126B
Conjugate Unconjugated
Supplier Page Shop

Product images