RNF182 Antibody

Name RNF182 Antibody
Supplier Novus Biologicals
Catalog NBP1-59763
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNF182(ring finger protein 182) The peptide sequence was selected from the middle region of RNF182. Peptide sequence LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNF182
Conjugate Unconjugated
Supplier Page Shop

Product images