TMEM108 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57849
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TMEM108 (transmembrane protein 108) The peptide sequence was selected from the middle region of TMEM108. Peptide sequence NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: TMEM108
• Conjugate: Unconjugated