Glucose Transporter GLUT8 Antibody
| Name | Glucose Transporter GLUT8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59812 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC2A8(solute carrier family 2 (facilitated glucose transporter), member 8) The peptide sequence was selected from the middle region of SLC2A8. Peptide sequence VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPV |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC2A8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24289_Glucose-Transporter-GLUT8-Antibody-Western-Blot-NBP1-59812-img0003.jpg)
Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24290_Glucose-Transporter-GLUT8-Antibody-Western-Blot-NBP1-59812-img0002.jpg)
Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24291_Glucose%2520Transporter%2520GLUT8%2520Antibody-Western%2520Blot-NBP1-59812-img0004.jpg)
Western Blot: Glucose Transporter GLUT8 Antibody [NBP1-59812] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.