SLCO6A1 Antibody

Name SLCO6A1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59899
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLCO6A1(solute carrier organic anion transporter family, member 6A1) The peptide sequence was selected from the C terminal of SLCO6A1. Peptide sequence LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene SLCO6A1
Conjugate Unconjugated
Supplier Page Shop

Product images