Name | SLC35E2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59842 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Horse, Rabbit |
Antigen | Synthetic peptides corresponding to SLC35E2 (solute carrier family 35, member E2) The peptide sequence was selected from the middle region of SLC35E2)(50ug). Peptide sequence AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC35E2 |
Supplier Page | Shop |