SLC35E2 Antibody

Name SLC35E2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59842
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Horse, Rabbit
Antigen Synthetic peptides corresponding to SLC35E2 (solute carrier family 35, member E2) The peptide sequence was selected from the middle region of SLC35E2)(50ug). Peptide sequence AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC35E2
Supplier Page Shop

Product images