Name | SLC5A9 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59873 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC5A9(solute carrier family 5 (sodium/glucose cotransporter), member 9) The peptide sequence was selected from the N terminal of SLC5A9. Peptide sequence MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFV |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC5A9 |
Conjugate | Unconjugated |
Supplier Page | Shop |