SLC5A9 Antibody

Name SLC5A9 Antibody
Supplier Novus Biologicals
Catalog NBP1-59873
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC5A9(solute carrier family 5 (sodium/glucose cotransporter), member 9) The peptide sequence was selected from the N terminal of SLC5A9. Peptide sequence MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFV
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC5A9
Conjugate Unconjugated
Supplier Page Shop

Product images