EMID1 Antibody

Name EMID1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62472
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EMID1(EMI domain containing 1) The peptide sequence was selected from the C terminal of EMID1. Peptide sequence TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EMID1
Conjugate Unconjugated
Supplier Page Shop

Product images