SLC9A7 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-62455
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC9A7(solute carrier family 9 (sodium/hydrogen exchanger), member 7) The peptide sequence was selected from the N terminal of SLC9A7. Peptide sequence LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC9A7
• Conjugate: Unconjugated