TSPAN8/TM4SF3 Antibody
| Name | TSPAN8/TM4SF3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62380 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TSPAN8(tetraspanin 8) The peptide sequence was selected from the middle region of TSPAN8. Peptide sequence VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TSPAN8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TM4SF3 Antibody [NBP1-62380] - Human Brain lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6907_TM4SF3%2520Antibody-Western%2520Blot-NBP1-62380-img0003.jpg)
![Western Blot: TM4SF3 Antibody [NBP1-62380] - Expressed in E. coli, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6908_TM4SF3%2520Antibody-Western%2520Blot-NBP1-62380-img0002.jpg)