C12orf49 Antibody

Name C12orf49 Antibody
Supplier Novus Biologicals
Catalog NBP1-62508
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C12ORF49 The peptide sequence was selected from the C terminal of C12ORF49. Peptide sequence LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C12orf49
Conjugate Unconjugated
Supplier Page Shop

Product images