SLC22A11 Antibody

Name SLC22A11 Antibody
Supplier Novus Biologicals
Catalog NBP1-62501
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC22A11(solute carrier family 22 (organic anion/urate transporter), member 11) The peptide sequence was selected from the N terminal of SLC22A11. Peptide sequence MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLEN
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene SLC22A11
Conjugate Unconjugated
Supplier Page Shop

Product images