TMTC1 Antibody

Name TMTC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62335
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMTC1(transmembrane and tetratricopeptide repeat containing 1) The peptide sequence was selected from the middle region of TMTC1. Peptide sequence LFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMTC1
Conjugate Unconjugated
Supplier Page Shop

Product images