SLC35A3 Antibody

Name SLC35A3 Antibody
Supplier Novus Biologicals
Catalog NBP1-62522
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Rabbit
Antigen Synthetic peptides corresponding to SLC35A3(solute carrier family 35 (UDP-N-acetylglucosamine transporter), member A3) The peptide sequence was selected from the middle region of SLC35A3. Peptide sequence VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACF
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC35A3
Supplier Page Shop

Product images