Name | SLC35A3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62522 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Bovine, Rabbit |
Antigen | Synthetic peptides corresponding to SLC35A3(solute carrier family 35 (UDP-N-acetylglucosamine transporter), member A3) The peptide sequence was selected from the middle region of SLC35A3. Peptide sequence VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACF |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC35A3 |
Supplier Page | Shop |