BAD-LAMP/LAMP5 Antibody
| Name | BAD-LAMP/LAMP5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62565 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C20ORF103 The peptide sequence was selected from the middle region of C20ORF103. Peptide sequence CQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDERE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LAMP5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: BAD-LAMP/LAMP5 Antibody [NBP1-62565] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7020_BAD-LAMP-LAMP5-Antibody-Western-Blot-NBP1-62565-img0002.jpg)
![Western Blot: BAD-LAMP/LAMP5 Antibody [NBP1-62565] - Placenta lysates, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7021_BAD-LAMP-LAMP5%2520Antibody-Western%2520Blot-NBP1-62565-img0003.jpg)