SFXN4 Antibody
| Name | SFXN4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60073 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | Synthetic peptides corresponding to SFXN4(sideroflexin 4) The peptide sequence was selected from the C terminal of SFXN4. Peptide sequence SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV. |
| Description | Rabbit Polyclonal |
| Gene | SFXN4 |
| Supplier Page | Shop |
Product images
![Western Blot: SFXN4 Antibody [NBP1-60073] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/13959_SFXN4-Antibody-Western-Blot-NBP1-60073-img0003.jpg)
Western Blot: SFXN4 Antibody [NBP1-60073] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.