LRRN4CL Antibody
| Name | LRRN4CL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60105 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat, Horse |
| Antigen | Synthetic peptides corresponding to LOC221091 The peptide sequence was selected from the middle region of LOC221091. Peptide sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LRRN4CL |
| Supplier Page | Shop |
Product images
![Western Blot: LRRN4CL Antibody [NBP1-60105] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/13962_LRRN4CL%2520Antibody-Western%2520Blot-NBP1-60105-img0002.jpg)
Western Blot: LRRN4CL Antibody [NBP1-60105] - 721_B cell lysate, concentration 0.2-1 ug/ml.