PCDHGB1 Antibody

Name PCDHGB1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59240
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCDHGB1(protocadherin gamma subfamily B, 1) The peptide sequence was selected from the N terminal of PCDHGB1. Peptide sequence SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCDHGB1
Conjugate Unconjugated
Supplier Page Shop

Product images