PCDHA6 Antibody

Name PCDHA6 Antibody
Supplier Novus Biologicals
Catalog NBP1-59262
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCDHA6(protocadherin alpha 6) The peptide sequence was selected from the C terminal of PCDHA6. Peptide sequence LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCDHA6
Conjugate Unconjugated
Supplier Page Shop

Product images