PCDHA10 Antibody

Name PCDHA10 Antibody
Supplier Novus Biologicals
Catalog NBP1-59258
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCDHA10(protocadherin alpha 10) The peptide sequence was selected from the N terminal of PCDHA10. Peptide sequence ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCDHA10
Conjugate Unconjugated
Supplier Page Shop

Product images