Ninjurin-1 Antibody

Name Ninjurin-1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59210
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NINJ1(ninjurin 1) The peptide sequence was selected from the N terminal of NINJ1. Peptide sequence DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NINJ1
Conjugate Unconjugated
Supplier Page Shop

Product images