PCDHGC4 Antibody
| Name | PCDHGC4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59236 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PCDHGC4(protocadherin gamma subfamily C, 4) The peptide sequence was selected from the N terminal of PCDHGC4. Peptide sequence VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PCDHGC4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PCDHGC4 Antibody [NBP1-59236] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24473_PCDHGC4-Antibody-Western-Blot-NBP1-59236-img0002.jpg)
Western Blot: PCDHGC4 Antibody [NBP1-59236] - 293T cells lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: PCDHGC4 Antibody [NBP1-59236] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24474_PCDHGC4%2520Antibody-Immunohistochemistry-NBP1-59236-img0003.jpg)
Immunohistochemistry: PCDHGC4 Antibody [NBP1-59236] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.