PCDHGA4 Antibody

Name PCDHGA4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59234
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen Synthetic peptides corresponding to PCDHGA4(protocadherin gamma subfamily A, 4) The peptide sequence was selected from the N terminal of PCDHGA4. Peptide sequence GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PCDHGA4
Supplier Page Shop

Product images