GIMAP5 Antibody

Name GIMAP5 Antibody
Supplier Novus Biologicals
Catalog NBP1-59485
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GIMAP5(GTPase, IMAP family member 5) The peptide sequence was selected from the middle region of GIMAP5 (NP_060854). Peptide sequence CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GIMAP5
Conjugate Unconjugated
Supplier Page Shop

Product images