RNF148 Antibody

Name RNF148 Antibody
Supplier Novus Biologicals
Catalog NBP1-59516
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNF148(ring finger protein 148) The peptide sequence was selected from the C terminal of RNF148 (NP_932351). Peptide sequence PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNF148
Conjugate Unconjugated
Supplier Page Shop

Product images