C16orf58 Antibody
| Name | C16orf58 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59541 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C16ORF58 The peptide sequence was selected from the N terminal of C16ORF58. Peptide sequence QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C16orf58 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C16orf58 Antibody [NBP1-59541] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24554_C16orf58-Antibody-Western-Blot-NBP1-59541-img0003.jpg)
Western Blot: C16orf58 Antibody [NBP1-59541] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
![Immunohistochemistry: C16orf58 Antibody [NBP1-59541] - Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue Observed Staining: Plasma membrane in spermatogonia and spermatocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24555_C16orf58-Antibody-Immunohistochemistry-NBP1-59541-img0004.jpg)
Immunohistochemistry: C16orf58 Antibody [NBP1-59541] - Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue Observed Staining: Plasma membrane in spermatogonia and spermatocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec