OR10X1 Antibody

Name OR10X1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59629
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR10X1(olfactory receptor, family 10, subfamily X, member 1) The peptide sequence was selected from the middle region of OR10X1. Peptide sequence NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR10X1
Conjugate Unconjugated
Supplier Page Shop

Product images