C6orf64 Antibody
| Name | C6orf64 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60043 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C6ORF64 The peptide sequence was selected from the C terminal of C6ORF64. Peptide sequence MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SAYSD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C6orf64 Antibody [NBP1-60043] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16074_C6orf64-Antibody-Western-Blot-NBP1-60043-img0002.jpg)
Western Blot: C6orf64 Antibody [NBP1-60043] - 293T cells lysate, concentration 0.2-1 ug/ml.