C7orf62 Antibody

Name C7orf62 Antibody
Supplier Novus Biologicals
Catalog NBP1-70480
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MGC26647(hypothetical protein MGC26647) The peptide sequence was selected from the N terminal of MGC26647. Peptide sequence EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C7orf62
Conjugate Unconjugated
Supplier Page Shop

Product images