ANKRD13D Antibody

Name ANKRD13D Antibody
Supplier Novus Biologicals
Catalog NBP1-70408
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ANKRD13D (ankyrin repeat domain 13 family, member D) The peptide sequence was selected from the middle region of ANKRD13D. Peptide sequence ARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANKRD13D
Conjugate Unconjugated
Supplier Page Shop

Product images