C2orf55 Antibody
| Name | C2orf55 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70468 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Horse, Rabbit |
| Antigen | Synthetic peptides corresponding to C2ORF55 The peptide sequence was selected from the middle region of C2ORF55. Peptide sequence ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KIAA1211L |
| Supplier Page | Shop |
Product images
![Western Blot: C2orf55 Antibody [NBP1-70468] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14005_C2orf55%2520Antibody-Western%2520Blot-NBP1-70468-img0003.jpg)
Western Blot: C2orf55 Antibody [NBP1-70468] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.