C2orf42 Antibody

Name C2orf42 Antibody
Supplier Novus Biologicals
Catalog NBP1-70466
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C2ORF42 The peptide sequence was selected from the N terminal of C2ORF42. Peptide sequence EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C2orf42
Conjugate Unconjugated
Supplier Page Shop

Product images