C12orf4 Antibody
| Name | C12orf4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70430 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C12ORF4 Antibody(against the N terminal of C12orf4. Peptide sequence EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C12orf4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C12orf4 Antibody [NBP1-70430] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16482_C12orf4%2520Antibody-Western%2520Blot-NBP1-70430-img0003.jpg)
Western Blot: C12orf4 Antibody [NBP1-70430] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.