Buster3 Antibody

Name Buster3 Antibody
Supplier Novus Biologicals
Catalog NBP1-70425
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LOC63920 (chromosome 5 open reading frame 54) The peptide sequence was selected from the N terminal of LOC63920)(50ug). Peptide sequence SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZBED8
Conjugate Unconjugated
Supplier Page Shop

Product images